Anti SYNGR1 pAb (ATL-HPA029673)

Atlas Antibodies

Catalog No.:
ATL-HPA029673-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synaptogyrin 1
Gene Name: SYNGR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022415: 90%, ENSRNOG00000017108: 88%
Entrez Gene ID: 9145
Uniprot ID: O43759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQG
Gene Sequence QRYQIGADSALFSQDYMDPSQDSSMPYAPYVEPTGPDPAGMGGTYQQPANTFDTEPQG
Gene ID - Mouse ENSMUSG00000022415
Gene ID - Rat ENSRNOG00000017108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYNGR1 pAb (ATL-HPA029673)
Datasheet Anti SYNGR1 pAb (ATL-HPA029673) Datasheet (External Link)
Vendor Page Anti SYNGR1 pAb (ATL-HPA029673) at Atlas Antibodies

Documents & Links for Anti SYNGR1 pAb (ATL-HPA029673)
Datasheet Anti SYNGR1 pAb (ATL-HPA029673) Datasheet (External Link)
Vendor Page Anti SYNGR1 pAb (ATL-HPA029673)