Anti SYN2 pAb (ATL-HPA037012)

Atlas Antibodies

Catalog No.:
ATL-HPA037012-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synapsin II
Gene Name: SYN2
Alternative Gene Name: SYNII, SYNIIa, SYNIIb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009394: 96%, ENSRNOG00000008157: 96%
Entrez Gene ID: 6854
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGEHQVEDRQLITELVISKMNQLLSRTPALSPQRPLTTQQPQSGTLKDPDSSKTPP
Gene Sequence IGEHQVEDRQLITELVISKMNQLLSRTPALSPQRPLTTQQPQSGTLKDPDSSKTPP
Gene ID - Mouse ENSMUSG00000009394
Gene ID - Rat ENSRNOG00000008157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYN2 pAb (ATL-HPA037012)
Datasheet Anti SYN2 pAb (ATL-HPA037012) Datasheet (External Link)
Vendor Page Anti SYN2 pAb (ATL-HPA037012) at Atlas Antibodies

Documents & Links for Anti SYN2 pAb (ATL-HPA037012)
Datasheet Anti SYN2 pAb (ATL-HPA037012) Datasheet (External Link)
Vendor Page Anti SYN2 pAb (ATL-HPA037012)