Anti SYMPK pAb (ATL-HPA041756)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041756-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SYMPK
Alternative Gene Name: SPK, SYM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023118: 100%, ENSRNOG00000014353: 100%
Entrez Gene ID: 8189
Uniprot ID: Q92797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA |
| Gene Sequence | PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA |
| Gene ID - Mouse | ENSMUSG00000023118 |
| Gene ID - Rat | ENSRNOG00000014353 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYMPK pAb (ATL-HPA041756) | |
| Datasheet | Anti SYMPK pAb (ATL-HPA041756) Datasheet (External Link) |
| Vendor Page | Anti SYMPK pAb (ATL-HPA041756) at Atlas Antibodies |
| Documents & Links for Anti SYMPK pAb (ATL-HPA041756) | |
| Datasheet | Anti SYMPK pAb (ATL-HPA041756) Datasheet (External Link) |
| Vendor Page | Anti SYMPK pAb (ATL-HPA041756) |