Anti SYMPK pAb (ATL-HPA041756)

Atlas Antibodies

Catalog No.:
ATL-HPA041756-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: symplekin
Gene Name: SYMPK
Alternative Gene Name: SPK, SYM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023118: 100%, ENSRNOG00000014353: 100%
Entrez Gene ID: 8189
Uniprot ID: Q92797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA
Gene Sequence PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA
Gene ID - Mouse ENSMUSG00000023118
Gene ID - Rat ENSRNOG00000014353
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYMPK pAb (ATL-HPA041756)
Datasheet Anti SYMPK pAb (ATL-HPA041756) Datasheet (External Link)
Vendor Page Anti SYMPK pAb (ATL-HPA041756) at Atlas Antibodies

Documents & Links for Anti SYMPK pAb (ATL-HPA041756)
Datasheet Anti SYMPK pAb (ATL-HPA041756) Datasheet (External Link)
Vendor Page Anti SYMPK pAb (ATL-HPA041756)