Anti SURF2 pAb (ATL-HPA044340)

Atlas Antibodies

Catalog No.:
ATL-HPA044340-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: surfeit 2
Gene Name: SURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014873: 78%, ENSRNOG00000047187: 77%
Entrez Gene ID: 6835
Uniprot ID: Q15527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPHIVPSTKNPHQLFCKLT
Gene Sequence MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPHIVPSTKNPHQLFCKLT
Gene ID - Mouse ENSMUSG00000014873
Gene ID - Rat ENSRNOG00000047187
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SURF2 pAb (ATL-HPA044340)
Datasheet Anti SURF2 pAb (ATL-HPA044340) Datasheet (External Link)
Vendor Page Anti SURF2 pAb (ATL-HPA044340) at Atlas Antibodies

Documents & Links for Anti SURF2 pAb (ATL-HPA044340)
Datasheet Anti SURF2 pAb (ATL-HPA044340) Datasheet (External Link)
Vendor Page Anti SURF2 pAb (ATL-HPA044340)