Anti SULT2B1 pAb (ATL-HPA043539 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043539-25

Protein Description: sulfotransferase family, cytosolic, 2B, member 1
Gene Name: SULT2B1
Alternative Gene Name: HSST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003271: 69%, ENSRNOG00000021046: 72%
Entrez Gene ID: 6820
Uniprot ID: O00204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS
• Gene Sequence: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS
• Gene ID - Mouse: ENSMUSG00000003271
• Gene ID - Rat: ENSRNOG00000021046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SULT2B1 pAb (ATL-HPA043539 w/enhanced validation) – 1 Found

Heinz, Lisa; Kim, Gwang-Jin; Marrakchi, Slaheddine; Christiansen, Julie; Turki, Hamida; Rauschendorf, Marc-Alexander; Lathrop, Mark; Hausser, Ingrid; Zimmer, Andreas D; Fischer, Judith. Mutations in SULT2B1 Cause Autosomal-Recessive Congenital Ichthyosis in Humans. American Journal Of Human Genetics. 2017;100(6):926-939.