Anti SUDS3 pAb (ATL-HPA041972)

Atlas Antibodies

Catalog No.:
ATL-HPA041972-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: suppressor of defective silencing 3 homolog (S. cerevisiae)
Gene Name: SUDS3
Alternative Gene Name: FLJ00052, SAP45, SDS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066900: 100%, ENSRNOG00000001139: 100%
Entrez Gene ID: 64426
Uniprot ID: Q9H7L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPA
Gene Sequence KAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPA
Gene ID - Mouse ENSMUSG00000066900
Gene ID - Rat ENSRNOG00000001139
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUDS3 pAb (ATL-HPA041972)
Datasheet Anti SUDS3 pAb (ATL-HPA041972) Datasheet (External Link)
Vendor Page Anti SUDS3 pAb (ATL-HPA041972) at Atlas Antibodies

Documents & Links for Anti SUDS3 pAb (ATL-HPA041972)
Datasheet Anti SUDS3 pAb (ATL-HPA041972) Datasheet (External Link)
Vendor Page Anti SUDS3 pAb (ATL-HPA041972)