Anti SUDS3 pAb (ATL-HPA041972)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041972-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SUDS3
Alternative Gene Name: FLJ00052, SAP45, SDS3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066900: 100%, ENSRNOG00000001139: 100%
Entrez Gene ID: 64426
Uniprot ID: Q9H7L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPA |
| Gene Sequence | KAAVKEFEDKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPA |
| Gene ID - Mouse | ENSMUSG00000066900 |
| Gene ID - Rat | ENSRNOG00000001139 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SUDS3 pAb (ATL-HPA041972) | |
| Datasheet | Anti SUDS3 pAb (ATL-HPA041972) Datasheet (External Link) |
| Vendor Page | Anti SUDS3 pAb (ATL-HPA041972) at Atlas Antibodies |
| Documents & Links for Anti SUDS3 pAb (ATL-HPA041972) | |
| Datasheet | Anti SUDS3 pAb (ATL-HPA041972) Datasheet (External Link) |
| Vendor Page | Anti SUDS3 pAb (ATL-HPA041972) |