Anti SUB1 pAb (ATL-HPA001311)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001311-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: SUB1
Alternative Gene Name: p14, p15, PC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022205: 93%, ENSRNOG00000050563: 93%
Entrez Gene ID: 10923
Uniprot ID: P53999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI |
| Gene Sequence | VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI |
| Gene ID - Mouse | ENSMUSG00000022205 |
| Gene ID - Rat | ENSRNOG00000050563 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SUB1 pAb (ATL-HPA001311) | |
| Datasheet | Anti SUB1 pAb (ATL-HPA001311) Datasheet (External Link) |
| Vendor Page | Anti SUB1 pAb (ATL-HPA001311) at Atlas Antibodies |
| Documents & Links for Anti SUB1 pAb (ATL-HPA001311) | |
| Datasheet | Anti SUB1 pAb (ATL-HPA001311) Datasheet (External Link) |
| Vendor Page | Anti SUB1 pAb (ATL-HPA001311) |
| Citations for Anti SUB1 pAb (ATL-HPA001311) – 1 Found |
| Luo, Yuechen; Xu, Changlu; Wang, Bing; Niu, Qing; Su, Xiuhua; Bai, Yingnan; Zhu, Shuxian; Zhao, Chunxiao; Sun, Yunyan; Wang, Jiali; Liu, Maolan; Sun, Xiaolei; Song, Ge; Cui, Haidong; Chen, Xiaoli; Huang, Huifang; Wang, Haikun; Han, Mingzhe; Jiang, Erlie; Shi, Lihong; Feng, Xiaoming. Single-cell transcriptomic analysis reveals disparate effector differentiation pathways in human T(reg) compartment. Nature Communications. 2021;12(1):3913. PubMed |