Anti SUB1 pAb (ATL-HPA001311)

Atlas Antibodies

Catalog No.:
ATL-HPA001311-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: SUB1 homolog (S. cerevisiae)
Gene Name: SUB1
Alternative Gene Name: p14, p15, PC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022205: 93%, ENSRNOG00000050563: 93%
Entrez Gene ID: 10923
Uniprot ID: P53999
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
Gene Sequence VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI
Gene ID - Mouse ENSMUSG00000022205
Gene ID - Rat ENSRNOG00000050563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUB1 pAb (ATL-HPA001311)
Datasheet Anti SUB1 pAb (ATL-HPA001311) Datasheet (External Link)
Vendor Page Anti SUB1 pAb (ATL-HPA001311) at Atlas Antibodies

Documents & Links for Anti SUB1 pAb (ATL-HPA001311)
Datasheet Anti SUB1 pAb (ATL-HPA001311) Datasheet (External Link)
Vendor Page Anti SUB1 pAb (ATL-HPA001311)
Citations for Anti SUB1 pAb (ATL-HPA001311) – 1 Found
Luo, Yuechen; Xu, Changlu; Wang, Bing; Niu, Qing; Su, Xiuhua; Bai, Yingnan; Zhu, Shuxian; Zhao, Chunxiao; Sun, Yunyan; Wang, Jiali; Liu, Maolan; Sun, Xiaolei; Song, Ge; Cui, Haidong; Chen, Xiaoli; Huang, Huifang; Wang, Haikun; Han, Mingzhe; Jiang, Erlie; Shi, Lihong; Feng, Xiaoming. Single-cell transcriptomic analysis reveals disparate effector differentiation pathways in human T(reg) compartment. Nature Communications. 2021;12(1):3913.  PubMed