Anti STXBP6 pAb (ATL-HPA003552 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003552-25

Protein Description: syntaxin binding protein 6 (amisyn)
Gene Name: STXBP6
Alternative Gene Name: amisyn, HSPC156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046314: 99%, ENSRNOG00000004198: 99%
Entrez Gene ID: 29091
Uniprot ID: Q8NFX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK
• Gene Sequence: NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK
• Gene ID - Mouse: ENSMUSG00000046314
• Gene ID - Rat: ENSRNOG00000004198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STXBP6 pAb (ATL-HPA003552 w/enhanced validation) – 1 Found

Wang, Weijie; Lin, Yi; Zhang, Guanghui; Shi, Guofu; Jiang, Yongsheng; Hu, Wentao; Zuo, Wei. circ_0002346 Suppresses Non-Small-Cell Lung Cancer Progression Depending on the Regulation of the miR-582-3p/STXBP6 Axis. International Journal Of Genomics. 2021( 34722753):1565660.