Anti STOM pAb (ATL-HPA011419)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011419-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STOM
Alternative Gene Name: BND7, EPB7, EPB72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026880: 96%, ENSRNOG00000019147: 96%
Entrez Gene ID: 2040
Uniprot ID: P27105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDA |
| Gene Sequence | ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDA |
| Gene ID - Mouse | ENSMUSG00000026880 |
| Gene ID - Rat | ENSRNOG00000019147 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STOM pAb (ATL-HPA011419) | |
| Datasheet | Anti STOM pAb (ATL-HPA011419) Datasheet (External Link) |
| Vendor Page | Anti STOM pAb (ATL-HPA011419) at Atlas Antibodies |
| Documents & Links for Anti STOM pAb (ATL-HPA011419) | |
| Datasheet | Anti STOM pAb (ATL-HPA011419) Datasheet (External Link) |
| Vendor Page | Anti STOM pAb (ATL-HPA011419) |
| Citations for Anti STOM pAb (ATL-HPA011419) – 2 Found |
| Chen, Chin-Yau; Yang, Chih-Yung; Chen, Yen-Chung; Shih, Chia-Wen; Lo, Su-Shun; Lin, Chi-Hung. Decreased expression of stomatin predicts poor prognosis in HER2-positive breast cancer. Bmc Cancer. 2016;16(1):697. PubMed |
| Gonzalez-Velandia, Kevin Y; Hernandez-Clavijo, Andres; Menini, Anna; Dibattista, Michele; Pifferi, Simone. Expression pattern of Stomatin-domain proteins in the peripheral olfactory system. Scientific Reports. 2022;12(1):11447. PubMed |