Anti STK4 pAb (ATL-HPA015270 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015270-25

Protein Description: serine/threonine kinase 4
Gene Name: STK4
Alternative Gene Name: KRS2, MST1, YSK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018209: 94%, ENSRNOG00000013529: 94%
Entrez Gene ID: 6789
Uniprot ID: Q13043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
• Gene Sequence: IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
• Gene ID - Mouse: ENSMUSG00000018209
• Gene ID - Rat: ENSRNOG00000013529
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STK4 pAb (ATL-HPA015270 w/enhanced validation) – 1 Found

Babel, Ingrid; Barderas, Rodrigo; Diaz-Uriarte, Ramón; Moreno, Víctor; Suarez, Adolfo; Fernandez-Aceñero, María Jesús; Salazar, Ramón; Capellá, Gabriel; Casal, J Ignacio. Identification of MST1/STK4 and SULF1 proteins as autoantibody targets for the diagnosis of colorectal cancer by using phage microarrays. Molecular & Cellular Proteomics : Mcp. 2011;10(3):M110.001784.