Anti STK32A pAb (ATL-HPA040236)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040236-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STK32A
Alternative Gene Name: MGC22688, YANK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039954: 87%, ENSRNOG00000027066: 84%
Entrez Gene ID: 202374
Uniprot ID: Q8WU08
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP |
| Gene Sequence | HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP |
| Gene ID - Mouse | ENSMUSG00000039954 |
| Gene ID - Rat | ENSRNOG00000027066 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK32A pAb (ATL-HPA040236) | |
| Datasheet | Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link) |
| Vendor Page | Anti STK32A pAb (ATL-HPA040236) at Atlas Antibodies |
| Documents & Links for Anti STK32A pAb (ATL-HPA040236) | |
| Datasheet | Anti STK32A pAb (ATL-HPA040236) Datasheet (External Link) |
| Vendor Page | Anti STK32A pAb (ATL-HPA040236) |