Anti STK19 pAb (ATL-HPA031510)

Atlas Antibodies

Catalog No.:
ATL-HPA031510-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 19
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039683: 35%, ENSRNOG00000052707: 30%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Gene Sequence SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Gene ID - Mouse ENSMUSG00000039683
Gene ID - Rat ENSRNOG00000052707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK19 pAb (ATL-HPA031510)
Datasheet Anti STK19 pAb (ATL-HPA031510) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA031510) at Atlas Antibodies

Documents & Links for Anti STK19 pAb (ATL-HPA031510)
Datasheet Anti STK19 pAb (ATL-HPA031510) Datasheet (External Link)
Vendor Page Anti STK19 pAb (ATL-HPA031510)