Anti STK19 pAb (ATL-HPA031510)

Atlas Antibodies

Catalog No.: ATL-HPA031510-25

Protein Description: serine/threonine kinase 19
Gene Name: STK19
Alternative Gene Name: D6S60, G11, RP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039683: 35%, ENSRNOG00000052707: 30%
Entrez Gene ID: 8859
Uniprot ID: P49842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
• Gene Sequence: SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
• Gene ID - Mouse: ENSMUSG00000039683
• Gene ID - Rat: ENSRNOG00000052707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.