Anti STK11IP pAb (ATL-HPA036838)

Atlas Antibodies

Catalog No.: ATL-HPA036838-25

Protein Description: serine/threonine kinase 11 interacting protein
Gene Name: STK11IP
Alternative Gene Name: KIAA1898, LIP1, LKB1IP, STK11IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026213: 79%, ENSRNOG00000020107: 83%
Entrez Gene ID: 114790
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MCLVVVSDRRLYLLKVTGEMREPPASWLQLTLAVPLQDLSGIELGLAGQSLRLEWAAGAGRCVLLPRDARHCRAFLEELLDVLQSL
• Gene Sequence: MCLVVVSDRRLYLLKVTGEMREPPASWLQLTLAVPLQDLSGIELGLAGQSLRLEWAAGAGRCVLLPRDARHCRAFLEELLDVLQSL
• Gene ID - Mouse: ENSMUSG00000026213
• Gene ID - Rat: ENSRNOG00000020107
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.