Anti STIM1 pAb (ATL-HPA012123 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012123-25

Protein Description: stromal interaction molecule 1
Gene Name: STIM1
Alternative Gene Name: D11S4896E, GOK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030987: 91%, ENSRNOG00000020425: 93%
Entrez Gene ID: 6786
Uniprot ID: Q13586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFK
• Gene Sequence: VHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFK
• Gene ID - Mouse: ENSMUSG00000030987
• Gene ID - Rat: ENSRNOG00000020425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STIM1 pAb (ATL-HPA012123 w/enhanced validation) – 7 Found

Gazda, Kinga; Kuznicki, Jacek; Wegierski, Tomasz. Knockdown of amyloid precursor protein increases calcium levels in the endoplasmic reticulum. Scientific Reports. 2017;7(1):14512. 

Latour, Simon; Mahouche, Isabelle; Cherrier, Floriane; Azzi-Martin, Lamia; Velasco, Valérie; Soubeyran, Pierre; Merlio, Jean-Philippe; Poglio, Sandrine; Bresson-Bepoldin, Laurence. Calcium Independent Effect of Orai1 and STIM1 in Non-Hodgkin B Cell Lymphoma Dissemination. Cancers. 2018;10(11) 

Huang, Chien-Yu; Wei, Po-Li; Chen, Wei-Yu; Chang, Wei-Chiao; Chang, Yu-Jia. Silencing Heat Shock Protein 27 Inhibits the Progression and Metastasis of Colorectal Cancer (CRC) by Maintaining the Stability of Stromal Interaction Molecule 1 (STIM1) Proteins. Cells. 2018;7(12) 

Wang, S; Choi, M; Richardson, A S; Reid, B M; Seymen, F; Yildirim, M; Tuna, E; Gençay, K; Simmer, J P; Hu, J C. STIM1 and SLC24A4 Are Critical for Enamel Maturation. Journal Of Dental Research. 2014;93(7 Suppl):94S-100S. 

Eckstein, Miriam; Vaeth, Martin; Fornai, Cinzia; Vinu, Manikandan; Bromage, Timothy G; Nurbaeva, Meerim K; Sorge, Jessica L; Coelho, Paulo G; Idaghdour, Youssef; Feske, Stefan; Lacruz, Rodrigo S. Store-operated Ca(2+) entry controls ameloblast cell function and enamel development. Jci Insight. 2017;2(6):e91166. 

Tiscione, Scott A; Vivas, Oscar; Ginsburg, Kenneth S; Bers, Donald M; Ory, Daniel S; Santana, Luis F; Dixon, Rose E; Dickson, Eamonn J. Disease-associated mutations in Niemann-Pick type C1 alter ER calcium signaling and neuronal plasticity. The Journal Of Cell Biology. 2019;218(12):4141-4156. 

Drobin, Kimi; Marczyk, Michal; Halle, Martin; Danielsson, Daniel; Papiez, Anna; Sangsuwan, Traimate; Bendes, Annika; Hong, Mun-Gwan; Qundos, Ulrika; Harms-Ringdahl, Mats; Wersäll, Peter; Polanska, Joanna; Schwenk, Jochen M; Haghdoost, Siamak. Molecular Profiling for Predictors of Radiosensitivity in Patients with Breast or Head-and-Neck Cancer. Cancers. 2020;12(3)