Anti STIM1 pAb (ATL-HPA011088 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011088-25

Protein Description: stromal interaction molecule 1
Gene Name: STIM1
Alternative Gene Name: D11S4896E, GOK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030987: 98%, ENSRNOG00000020425: 97%
Entrez Gene ID: 6786
Uniprot ID: Q13586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
• Gene Sequence: TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
• Gene ID - Mouse: ENSMUSG00000030987
• Gene ID - Rat: ENSRNOG00000020425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STIM1 pAb (ATL-HPA011088 w/enhanced validation) – 1 Found

Drobin, Kimi; Marczyk, Michal; Halle, Martin; Danielsson, Daniel; Papiez, Anna; Sangsuwan, Traimate; Bendes, Annika; Hong, Mun-Gwan; Qundos, Ulrika; Harms-Ringdahl, Mats; Wersäll, Peter; Polanska, Joanna; Schwenk, Jochen M; Haghdoost, Siamak. Molecular Profiling for Predictors of Radiosensitivity in Patients with Breast or Head-and-Neck Cancer. Cancers. 2020;12(3)