Anti STAB2 pAb (ATL-HPA026871 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026871-25

Protein Description: stabilin 2
Gene Name: STAB2
Alternative Gene Name: DKFZP434E0321, FEEL-2, FELL, HARE, STAB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035459: 77%, ENSRNOG00000038948: 79%
Entrez Gene ID: 55576
Uniprot ID: Q8WWQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
• Gene Sequence: VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
• Gene ID - Mouse: ENSMUSG00000035459
• Gene ID - Rat: ENSRNOG00000038948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STAB2 pAb (ATL-HPA026871 w/enhanced validation) – 2 Found

Kampf, Caroline; Mardinoglu, Adil; Fagerberg, Linn; Hallström, Björn M; Edlund, Karolina; Lundberg, Emma; Pontén, Fredrik; Nielsen, Jens; Uhlen, Mathias. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2014;28(7):2901-14. 

Bian, Tingting; Zhao, Jinli; Feng, Jia; Zhang, Qing; Qian, Li; Liu, Jian; Jiang, Daishan; Liu, Yifei; Zhang, Jianguo. Combination of cadherin-17 and SATB homeobox 2 serves as potential optimal makers for the differential diagnosis of pulmonary enteric adenocarcinoma and metastatic colorectal adenocarcinoma. Oncotarget. 2017;8(38):63442-63452.