Anti SSTR1 pAb (ATL-HPA031506)

Atlas Antibodies

Catalog No.: ATL-HPA031506-25

Protein Description: somatostatin receptor 1
Gene Name: SSTR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035431: 98%, ENSRNOG00000048145: 98%
Entrez Gene ID: 6751
Uniprot ID: P30872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCT
• Gene Sequence: FKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCT
• Gene ID - Mouse: ENSMUSG00000035431
• Gene ID - Rat: ENSRNOG00000048145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SSTR1 pAb (ATL-HPA031506) – 1 Found

Romiani, Arman; Spetz, Johan; Shubbar, Emman; Lind, Dan E; Hallberg, Bengt; Palmer, Ruth H; Forssell-Aronsson, Eva. Neuroblastoma xenograft models demonstrate the therapeutic potential of (177)Lu-octreotate. Bmc Cancer. 2021;21(1):950.