Anti SSRP1 pAb (ATL-HPA002697)

Atlas Antibodies

Catalog No.: ATL-HPA002697-100

Protein Description: structure specific recognition protein 1
Gene Name: SSRP1
Alternative Gene Name: FACT80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027067: 100%, ENSRNOG00000008825: 100%
Entrez Gene ID: 6749
Uniprot ID: Q08945
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE
• Gene Sequence: DDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVE
• Gene ID - Mouse: ENSMUSG00000027067
• Gene ID - Rat: ENSRNOG00000008825
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.