Anti SSR1 pAb (ATL-HPA011276 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011276-25

Protein Description: signal sequence receptor, alpha
Gene Name: SSR1
Alternative Gene Name: TRAPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021427: 98%, ENSRNOG00000014165: 100%
Entrez Gene ID: 6745
Uniprot ID: P43307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
• Gene Sequence: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
• Gene ID - Mouse: ENSMUSG00000021427
• Gene ID - Rat: ENSRNOG00000014165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SSR1 pAb (ATL-HPA011276 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Taylor, Martin S; Ruch, Travis R; Hsiao, Po-Yuan; Hwang, Yousang; Zhang, Pingfeng; Dai, Lixin; Huang, Cheng Ran Lisa; Berndsen, Christopher E; Kim, Min-Sik; Pandey, Akhilesh; Wolberger, Cynthia; Marmorstein, Ronen; Machamer, Carolyn; Boeke, Jef D; Cole, Philip A. Architectural organization of the metabolic regulatory enzyme ghrelin O-acyltransferase. The Journal Of Biological Chemistry. 2013;288(45):32211-32228.