Anti SSFA2 pAb (ATL-HPA039989)

Atlas Antibodies

Catalog No.:
ATL-HPA039989-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sperm specific antigen 2
Gene Name: SSFA2
Alternative Gene Name: CS-1, KIAA1927, KRAP, SPAG13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027007: 79%, ENSRNOG00000005865: 76%
Entrez Gene ID: 6744
Uniprot ID: P28290
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Gene Sequence EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Gene ID - Mouse ENSMUSG00000027007
Gene ID - Rat ENSRNOG00000005865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SSFA2 pAb (ATL-HPA039989)
Datasheet Anti SSFA2 pAb (ATL-HPA039989) Datasheet (External Link)
Vendor Page Anti SSFA2 pAb (ATL-HPA039989) at Atlas Antibodies

Documents & Links for Anti SSFA2 pAb (ATL-HPA039989)
Datasheet Anti SSFA2 pAb (ATL-HPA039989) Datasheet (External Link)
Vendor Page Anti SSFA2 pAb (ATL-HPA039989)