Anti SRSF5 pAb (ATL-HPA043484)

Atlas Antibodies

Catalog No.: ATL-HPA043484-25

Protein Description: serine/arginine-rich splicing factor 5
Gene Name: SRSF5
Alternative Gene Name: HRS, SFRS5, SRP40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021134: 100%, ENSRNOG00000005513: 100%
Entrez Gene ID: 6430
Uniprot ID: Q13243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE
• Gene Sequence: KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE
• Gene ID - Mouse: ENSMUSG00000021134
• Gene ID - Rat: ENSRNOG00000005513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SRSF5 pAb (ATL-HPA043484) – 1 Found

Park, Won Cheol; Kim, Hak-Ryul; Kang, Dong Baek; Ryu, Jae-Suk; Choi, Keum-Ha; Lee, Gyeong-Ok; Yun, Ki Jung; Kim, Keun Young; Park, Raekil; Yoon, Kwon-Ha; Cho, Ji-Hyun; Lee, Young-Jin; Chae, Soo-Cheon; Park, Min-Cheol; Park, Do-Sim. Comparative expression patterns and diagnostic efficacies of SR splicing factors and HNRNPA1 in gastric and colorectal cancer. Bmc Cancer. 2016;16( 27282379):358.