Anti SRC pAb (ATL-HPA030875 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030875-25

Protein Description: SRC proto-oncogene, non-receptor tyrosine kinase
Gene Name: SRC
Alternative Gene Name: ASV, c-src, SRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027646: 95%, ENSRNOG00000009495: 98%
Entrez Gene ID: 6714
Uniprot ID: P12931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
• Gene Sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
• Gene ID - Mouse: ENSMUSG00000027646
• Gene ID - Rat: ENSRNOG00000009495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.