Anti SPRYD7 pAb (ATL-HPA043934)

Atlas Antibodies

Catalog No.:
ATL-HPA043934-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SPRY domain containing 7
Gene Name: SPRYD7
Alternative Gene Name: C13orf1, CLLD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021930: 100%, ENSRNOG00000015095: 100%
Entrez Gene ID: 57213
Uniprot ID: Q5W111
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
Gene Sequence SLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
Gene ID - Mouse ENSMUSG00000021930
Gene ID - Rat ENSRNOG00000015095
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPRYD7 pAb (ATL-HPA043934)
Datasheet Anti SPRYD7 pAb (ATL-HPA043934) Datasheet (External Link)
Vendor Page Anti SPRYD7 pAb (ATL-HPA043934) at Atlas Antibodies

Documents & Links for Anti SPRYD7 pAb (ATL-HPA043934)
Datasheet Anti SPRYD7 pAb (ATL-HPA043934) Datasheet (External Link)
Vendor Page Anti SPRYD7 pAb (ATL-HPA043934)