Anti SPOPL pAb (ATL-HPA034687)

Atlas Antibodies

Catalog No.:
ATL-HPA034687-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: speckle-type POZ protein-like
Gene Name: SPOPL
Alternative Gene Name: BTBD33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026771: 98%, ENSRNOG00000005070: 97%
Entrez Gene ID: 339745
Uniprot ID: Q6IQ16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVA
Gene Sequence LHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETSGWKSMIQSHPHLVA
Gene ID - Mouse ENSMUSG00000026771
Gene ID - Rat ENSRNOG00000005070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SPOPL pAb (ATL-HPA034687)
Datasheet Anti SPOPL pAb (ATL-HPA034687) Datasheet (External Link)
Vendor Page Anti SPOPL pAb (ATL-HPA034687) at Atlas Antibodies

Documents & Links for Anti SPOPL pAb (ATL-HPA034687)
Datasheet Anti SPOPL pAb (ATL-HPA034687) Datasheet (External Link)
Vendor Page Anti SPOPL pAb (ATL-HPA034687)