Anti SPIRE1 pAb (ATL-HPA040942)

Atlas Antibodies

Catalog No.: ATL-HPA040942-25

Protein Description: spire-type actin nucleation factor 1
Gene Name: SPIRE1
Alternative Gene Name: KIAA1135, spir-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024533: 93%, ENSRNOG00000025324: 93%
Entrez Gene ID: 56907
Uniprot ID: Q08AE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQ
• Gene Sequence: LQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQ
• Gene ID - Mouse: ENSMUSG00000024533
• Gene ID - Rat: ENSRNOG00000025324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPIRE1 pAb (ATL-HPA040942) – 1 Found

Wen, Qing; Li, Nan; Xiao, Xiang; Lui, Wing-Yee; Chu, Darren S; Wong, Chris K C; Lian, Qingquan; Ge, Renshan; Lee, Will M; Silvestrini, Bruno; Cheng, C Yan. Actin nucleator Spire 1 is a regulator of ectoplasmic specialization in the testis. Cell Death & Disease. 2018;9(2):208.