Anti SPIRE1 pAb (ATL-HPA040737)

Atlas Antibodies

Catalog No.: ATL-HPA040737-25

Protein Description: spire-type actin nucleation factor 1
Gene Name: SPIRE1
Alternative Gene Name: KIAA1135, spir-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024533: 86%, ENSRNOG00000025324: 83%
Entrez Gene ID: 56907
Uniprot ID: Q08AE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK
• Gene Sequence: LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK
• Gene ID - Mouse: ENSMUSG00000024533
• Gene ID - Rat: ENSRNOG00000025324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.