Anti SPIN4 pAb (ATL-HPA044559)

Atlas Antibodies

Catalog No.: ATL-HPA044559-25

Protein Description: spindlin family, member 4
Gene Name: SPIN4
Alternative Gene Name: FLJ44984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071722: 93%, ENSRNOG00000011119: 43%
Entrez Gene ID: 139886
Uniprot ID: Q56A73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVG
• Gene Sequence: MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVG
• Gene ID - Mouse: ENSMUSG00000071722
• Gene ID - Rat: ENSRNOG00000011119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.