Anti SPATA5 pAb (ATL-HPA036451)

Atlas Antibodies

Catalog No.: ATL-HPA036451-25

Protein Description: spermatogenesis associated 5
Gene Name: SPATA5
Alternative Gene Name: AFG2, SPAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027722: 83%, ENSRNOG00000017462: 81%
Entrez Gene ID: 166378
Uniprot ID: Q8NB90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLYCTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMA
• Gene Sequence: IQVQPLVGAVLQAEEMDVALSDKDMEINEEELTGCILRKLDGKIVLPGNFLYCTFYGRPYKLQVLRVKGADGMILGGPQSDSDTDAQRMA
• Gene ID - Mouse: ENSMUSG00000027722
• Gene ID - Rat: ENSRNOG00000017462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.