Anti SPATA18 pAb (ATL-HPA036854 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036854-25

Protein Description: spermatogenesis associated 18
Gene Name: SPATA18
Alternative Gene Name: FLJ32906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029155: 67%, ENSRNOG00000002120: 70%
Entrez Gene ID: 132671
Uniprot ID: Q8TC71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSR
• Gene Sequence: AENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSR
• Gene ID - Mouse: ENSMUSG00000029155
• Gene ID - Rat: ENSRNOG00000002120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPATA18 pAb (ATL-HPA036854 w/enhanced validation) – 3 Found

Okuyama, Keiichiro; Kitajima, Yoshihiko; Egawa, Noriyuki; Kitagawa, Hiroshi; Ito, Kotaro; Aishima, Shinichi; Yanagihara, Kazuyoshi; Tanaka, Tomokazu; Noshiro, Hirokazu. Mieap-induced accumulation of lysosomes within mitochondria (MALM) regulates gastric cancer cell invasion under hypoxia by suppressing reactive oxygen species accumulation. Scientific Reports. 2019;9(1):2822. 

Dan, Xiuli; Babbar, Mansi; Moore, Anthony; Wechter, Noah; Tian, Jingyan; Mohanty, Joy G; Croteau, Deborah L; Bohr, Vilhelm A. DNA damage invokes mitophagy through a pathway involving Spata18. Nucleic Acids Research. 2020;48(12):6611-6623. 

Gerashchenko, Tatiana S; Zolotaryova, Sofia Y; Kiselev, Artem M; Tashireva, Liubov A; Novikov, Nikita M; Krakhmal, Nadezhda V; Cherdyntseva, Nadezhda V; Zavyalova, Marina V; Perelmuter, Vladimir M; Denisov, Evgeny V. The Activity of KIF14, Mieap, and EZR in a New Type of the Invasive Component, Torpedo-Like Structures, Predetermines the Metastatic Potential of Breast Cancer. Cancers. 2020;12(7)