Anti SPAG11B pAb (ATL-HPA023842)

Atlas Antibodies

Catalog No.: ATL-HPA023842-25

Protein Description: sperm associated antigen 11B
Gene Name: SPAG11B
Alternative Gene Name: EDDM2B, EP2, EP2C, EP2D, HE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110641: 54%, ENSRNOG00000013957: 54%
Entrez Gene ID: 10407
Uniprot ID: Q08648
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVPLGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI
• Gene Sequence: DVPLGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI
• Gene ID - Mouse: ENSMUSG00000110641
• Gene ID - Rat: ENSRNOG00000013957
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SPAG11B pAb (ATL-HPA023842) – 1 Found

Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11)