Anti SPACA1 pAb (ATL-HPA043297 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043297-25

Protein Description: sperm acrosome associated 1
Gene Name: SPACA1
Alternative Gene Name: SAMP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028264: 70%, ENSRNOG00000008232: 69%
Entrez Gene ID: 81833
Uniprot ID: Q9HBV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPA
• Gene Sequence: LRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPA
• Gene ID - Mouse: ENSMUSG00000028264
• Gene ID - Rat: ENSRNOG00000008232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.