Anti SP6 pAb (ATL-HPA044469)

Atlas Antibodies

Catalog No.:
ATL-HPA044469-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: Sp6 transcription factor
Gene Name: SP6
Alternative Gene Name: Epfn, KLF14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038560: 96%, ENSRNOG00000023551: 96%
Entrez Gene ID: 80320
Uniprot ID: Q3SY56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAP
Gene Sequence ESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAP
Gene ID - Mouse ENSMUSG00000038560
Gene ID - Rat ENSRNOG00000023551
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SP6 pAb (ATL-HPA044469)
Datasheet Anti SP6 pAb (ATL-HPA044469) Datasheet (External Link)
Vendor Page Anti SP6 pAb (ATL-HPA044469) at Atlas Antibodies

Documents & Links for Anti SP6 pAb (ATL-HPA044469)
Datasheet Anti SP6 pAb (ATL-HPA044469) Datasheet (External Link)
Vendor Page Anti SP6 pAb (ATL-HPA044469)