Anti SOX7 pAb (ATL-HPA009065)

Atlas Antibodies

Catalog No.: ATL-HPA009065-25

Protein Description: SRY (sex determining region Y)-box 7
Gene Name: SOX7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063060: 91%, ENSRNOG00000012049: 91%
Entrez Gene ID: 83595
Uniprot ID: Q9BT81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
• Gene Sequence: SPLHCSHPLGSLALGQSPGVSMMSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYS
• Gene ID - Mouse: ENSMUSG00000063060
• Gene ID - Rat: ENSRNOG00000012049
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SOX7 pAb (ATL-HPA009065) – 3 Found

Pijuan-Galitó, Sara; Tamm, Christoffer; Schuster, Jens; Sobol, Maria; Forsberg, Lars; Merry, Catherine L R; Annerén, Cecilia. Human serum-derived protein removes the need for coating in defined human pluripotent stem cell culture. Nature Communications. 2016;7( 27405751):12170. 

Saegusa, Makoto; Hashimura, Miki; Kuwata, Takeshi. Sox4 functions as a positive regulator of β-catenin signaling through upregulation of TCF4 during morular differentiation of endometrial carcinomas. Laboratory Investigation; A Journal Of Technical Methods And Pathology. 2012;92(4):511-21. 

Hayano, Takahide; Garg, Manoj; Yin, Dong; Sudo, Makoto; Kawamata, Norihiko; Shi, Shuo; Chien, Wenwen; Ding, Ling-Wen; Leong, Geraldine; Mori, Seiichi; Xie, Dong; Tan, Patrick; Koeffler, H Phillip. SOX7 is down-regulated in lung cancer. Journal Of Experimental & Clinical Cancer Research : Cr. 2013;32(1):17.