Anti SOSTDC1 pAb (ATL-HPA042856)

Atlas Antibodies

Catalog No.: ATL-HPA042856-25

Protein Description: sclerostin domain containing 1
Gene Name: SOSTDC1
Alternative Gene Name: DAND7, DKFZp564D206, USAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036169: 97%, ENSRNOG00000005770: 97%
Entrez Gene ID: 25928
Uniprot ID: Q6X4U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS
• Gene Sequence: GYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS
• Gene ID - Mouse: ENSMUSG00000036169
• Gene ID - Rat: ENSRNOG00000005770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.