Anti SORCS1 pAb (ATL-HPA011948)

Atlas Antibodies

Catalog No.:
ATL-HPA011948-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sortilin-related VPS10 domain containing receptor 1
Gene Name: SORCS1
Alternative Gene Name: sorCS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043531: 87%, ENSRNOG00000011313: 88%
Entrez Gene ID: 114815
Uniprot ID: Q8WY21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Gene Sequence EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Gene ID - Mouse ENSMUSG00000043531
Gene ID - Rat ENSRNOG00000011313
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SORCS1 pAb (ATL-HPA011948)
Datasheet Anti SORCS1 pAb (ATL-HPA011948) Datasheet (External Link)
Vendor Page Anti SORCS1 pAb (ATL-HPA011948) at Atlas Antibodies

Documents & Links for Anti SORCS1 pAb (ATL-HPA011948)
Datasheet Anti SORCS1 pAb (ATL-HPA011948) Datasheet (External Link)
Vendor Page Anti SORCS1 pAb (ATL-HPA011948)