Anti SON pAb (ATL-HPA031756)

Atlas Antibodies

Catalog No.: ATL-HPA031756-25

Protein Description: SON DNA binding protein
Gene Name: SON
Alternative Gene Name: BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022961: 77%, ENSRNOG00000002021: 77%
Entrez Gene ID: 6651
Uniprot ID: P18583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVAKVLEPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQELPELPKTTALE
• Gene Sequence: PVAKVLEPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQELPELPKTTALE
• Gene ID - Mouse: ENSMUSG00000022961
• Gene ID - Rat: ENSRNOG00000002021
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.