Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037419-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SNX7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028007: 95%, ENSRNOG00000017077: 93%
Entrez Gene ID: 51375
Uniprot ID: Q9UNH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEE |
| Gene Sequence | IADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEE |
| Gene ID - Mouse | ENSMUSG00000028007 |
| Gene ID - Rat | ENSRNOG00000017077 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) | |
| Datasheet | Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) | |
| Datasheet | Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) |
| Citations for Anti SNX7 pAb (ATL-HPA037419 w/enhanced validation) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |