Anti SNX18 pAb (ATL-HPA037800 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037800-25

Protein Description: sorting nexin 18
Gene Name: SNX18
Alternative Gene Name: SH3PX2, SH3PXD3B, SNAG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042364: 91%, ENSRNOG00000010971: 91%
Entrez Gene ID: 112574
Uniprot ID: Q96RF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN
• Gene Sequence: DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN
• Gene ID - Mouse: ENSMUSG00000042364
• Gene ID - Rat: ENSRNOG00000010971
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNX18 pAb (ATL-HPA037800 w/enhanced validation) – 1 Found

Søreng, Kristiane; Munson, Michael J; Lamb, Christopher A; Bjørndal, Gunnveig T; Pankiv, Serhiy; Carlsson, Sven R; Tooze, Sharon A; Simonsen, Anne. SNX18 regulates ATG9A trafficking from recycling endosomes by recruiting Dynamin-2. Embo Reports. 2018;19(4)