Anti SNX17 pAb (ATL-HPA043867)

Atlas Antibodies

Catalog No.: ATL-HPA043867-25

Protein Description: sorting nexin 17
Gene Name: SNX17
Alternative Gene Name: KIAA0064
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029146: 97%, ENSRNOG00000026884: 96%
Entrez Gene ID: 9784
Uniprot ID: Q15036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
• Gene Sequence: GTLRRSDSQQAVKSPPLLESPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
• Gene ID - Mouse: ENSMUSG00000029146
• Gene ID - Rat: ENSRNOG00000026884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNX17 pAb (ATL-HPA043867) – 2 Found

McNally, Kerrie E; Faulkner, Rebecca; Steinberg, Florian; Gallon, Matthew; Ghai, Rajesh; Pim, David; Langton, Paul; Pearson, Neil; Danson, Chris M; Nägele, Heike; Morris, Lindsey L; Singla, Amika; Overlee, Brittany L; Heesom, Kate J; Sessions, Richard; Banks, Lawrence; Collins, Brett M; Berger, Imre; Billadeau, Daniel D; Burstein, Ezra; Cullen, Peter J. Retriever is a multiprotein complex for retromer-independent endosomal cargo recycling. Nature Cell Biology. 2017;19(10):1214-1225. 

Giridharan, Sai Srinivas Panapakkam; Luo, Guangming; Rivero-Rios, Pilar; Steinfeld, Noah; Tronchere, Helene; Singla, Amika; Burstein, Ezra; Billadeau, Daniel D; Sutton, Michael A; Weisman, Lois S. Lipid kinases VPS34 and PIKfyve coordinate a phosphoinositide cascade to regulate retriever-mediated recycling on endosomes. Elife. 2022;11( 35040777)