Anti SNRPD3 pAb (ATL-HPA001170 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001170-25

Protein Description: small nuclear ribonucleoprotein D3 polypeptide 18kDa
Gene Name: SNRPD3
Alternative Gene Name: Sm-D3, SMD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020180: 100%, ENSRNOG00000050410: 100%
Entrez Gene ID: 6634
Uniprot ID: P62318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
• Gene Sequence: KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
• Gene ID - Mouse: ENSMUSG00000020180
• Gene ID - Rat: ENSRNOG00000050410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNRPD3 pAb (ATL-HPA001170 w/enhanced validation) – 3 Found

Xie, Wen; Denman, Robert B. Protein methylation and stress granules: posttranslational remodeler or innocent bystander?. Molecular Biology International. 2011( 22091395):137459. 

Braun, Christian J; Stanciu, Monica; Boutz, Paul L; Patterson, Jesse C; Calligaris, David; Higuchi, Fumi; Neupane, Rachit; Fenoglio, Silvia; Cahill, Daniel P; Wakimoto, Hiroaki; Agar, Nathalie Y R; Yaffe, Michael B; Sharp, Phillip A; Hemann, Michael T; Lees, Jacqueline A. Coordinated Splicing of Regulatory Detained Introns within Oncogenic Transcripts Creates an Exploitable Vulnerability in Malignant Glioma. Cancer Cell. 2017;32(4):411-426.e11. 

Czarnek, Maria; Sarad, Katarzyna; Karaś, Agnieszka; Kochan, Jakub; Bereta, Joanna. Non-targeting control for MISSION shRNA library silences SNRPD3 leading to cell death or permanent growth arrest. Molecular Therapy. Nucleic Acids. 2021;26( 34703654):711-731.