Anti SNRPD2 pAb (ATL-HPA041437)

Atlas Antibodies

Catalog No.: ATL-HPA041437-100

Protein Description: small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
Gene Name: SNRPD2
Alternative Gene Name: Sm-D2, SNRPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040824: 100%, ENSRNOG00000015844: 100%
Entrez Gene ID: 6633
Uniprot ID: P62316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE
• Gene Sequence: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE
• Gene ID - Mouse: ENSMUSG00000040824
• Gene ID - Rat: ENSRNOG00000015844
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.