Anti SNRPD1 pAb (ATL-HPA040516)

Atlas Antibodies

Catalog No.: ATL-HPA040516-25

Protein Description: small nuclear ribonucleoprotein D1 polypeptide 16kDa
Gene Name: SNRPD1
Alternative Gene Name: HsT2456, Sm-D1, SNRPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002477: 100%, ENSRNOG00000013714: 100%
Entrez Gene ID: 6632
Uniprot ID: P62314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
• Gene Sequence: SMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGR
• Gene ID - Mouse: ENSMUSG00000002477
• Gene ID - Rat: ENSRNOG00000013714
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.