Anti SNRNP25 pAb (ATL-HPA044248)

Atlas Antibodies

Catalog No.: ATL-HPA044248-25

Protein Description: small nuclear ribonucleoprotein 25kDa (U11/U12)
Gene Name: SNRNP25
Alternative Gene Name: C16orf33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040767: 70%, ENSRNOG00000020626: 70%
Entrez Gene ID: 79622
Uniprot ID: Q9BV90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEALPHSEAMDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEV
• Gene Sequence: EEALPHSEAMDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEV
• Gene ID - Mouse: ENSMUSG00000040767
• Gene ID - Rat: ENSRNOG00000020626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.