Anti SNAP29 pAb (ATL-HPA031823)

Atlas Antibodies

Catalog No.: ATL-HPA031823-25

Protein Description: synaptosomal-associated protein, 29kDa
Gene Name: SNAP29
Alternative Gene Name: CEDNIK, SNAP-29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022765: 89%, ENSRNOG00000001867: 92%
Entrez Gene ID: 9342
Uniprot ID: O95721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNI
• Gene Sequence: TDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNI
• Gene ID - Mouse: ENSMUSG00000022765
• Gene ID - Rat: ENSRNOG00000001867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SNAP29 pAb (ATL-HPA031823) – 1 Found

Hubert, Virginie; Peschel, Andrea; Langer, Brigitte; Gröger, Marion; Rees, Andrew; Kain, Renate. LAMP-2 is required for incorporating syntaxin-17 into autophagosomes and for their fusion with lysosomes. Biology Open. 2016;5(10):1516-1529.