Anti SMR3A pAb (ATL-HPA044567 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044567-25

Protein Description: submaxillary gland androgen regulated protein 3A
Gene Name: SMR3A
Alternative Gene Name: PBI, PRL5, PROL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039057: 48%, ENSRNOG00000031934: 46%
Entrez Gene ID: 26952
Uniprot ID: Q99954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP
• Gene Sequence: GPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP
• Gene ID - Mouse: ENSMUSG00000039057
• Gene ID - Rat: ENSRNOG00000031934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.