Anti SMPD2 pAb (ATL-HPA018125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018125-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SMPD2
Alternative Gene Name: ISC1, nSMase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019822: 76%, ENSRNOG00000000306: 82%
Entrez Gene ID: 6610
Uniprot ID: O60906
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST |
| Gene Sequence | QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST |
| Gene ID - Mouse | ENSMUSG00000019822 |
| Gene ID - Rat | ENSRNOG00000000306 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SMPD2 pAb (ATL-HPA018125) | |
| Datasheet | Anti SMPD2 pAb (ATL-HPA018125) Datasheet (External Link) |
| Vendor Page | Anti SMPD2 pAb (ATL-HPA018125) at Atlas Antibodies |
| Documents & Links for Anti SMPD2 pAb (ATL-HPA018125) | |
| Datasheet | Anti SMPD2 pAb (ATL-HPA018125) Datasheet (External Link) |
| Vendor Page | Anti SMPD2 pAb (ATL-HPA018125) |
| Citations for Anti SMPD2 pAb (ATL-HPA018125) – 1 Found |
| Menck, Kerstin; Sönmezer, Can; Worst, Thomas Stefan; Schulz, Matthias; Dihazi, Gry Helene; Streit, Frank; Erdmann, Gerrit; Kling, Simon; Boutros, Michael; Binder, Claudia; Gross, Julia Christina. Neutral sphingomyelinases control extracellular vesicles budding from the plasma membrane. Journal Of Extracellular Vesicles. 6(1):1378056. PubMed |