Anti SMG9 pAb (ATL-HPA041763)

Atlas Antibodies

Catalog No.:
ATL-HPA041763-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: SMG9 nonsense mediated mRNA decay factor
Gene Name: SMG9
Alternative Gene Name: C19orf61, FLJ12886
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002210: 99%, ENSRNOG00000019596: 96%
Entrez Gene ID: 56006
Uniprot ID: Q9H0W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLYRFLQTAEMVKPSTPSPSHESSSSSGSDEGTEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNV
Gene Sequence SLYRFLQTAEMVKPSTPSPSHESSSSSGSDEGTEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNV
Gene ID - Mouse ENSMUSG00000002210
Gene ID - Rat ENSRNOG00000019596
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SMG9 pAb (ATL-HPA041763)
Datasheet Anti SMG9 pAb (ATL-HPA041763) Datasheet (External Link)
Vendor Page Anti SMG9 pAb (ATL-HPA041763) at Atlas Antibodies

Documents & Links for Anti SMG9 pAb (ATL-HPA041763)
Datasheet Anti SMG9 pAb (ATL-HPA041763) Datasheet (External Link)
Vendor Page Anti SMG9 pAb (ATL-HPA041763)