Anti SMC6 pAb (ATL-HPA042733)

Atlas Antibodies

Catalog No.: ATL-HPA042733-25

Protein Description: structural maintenance of chromosomes 6
Gene Name: SMC6
Alternative Gene Name: FLJ22116, SMC6L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020608: 81%, ENSRNOG00000004908: 84%
Entrez Gene ID: 79677
Uniprot ID: Q96SB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL
• Gene Sequence: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL
• Gene ID - Mouse: ENSMUSG00000020608
• Gene ID - Rat: ENSRNOG00000004908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.