Anti SLU7 pAb (ATL-HPA035907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035907-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SLU7
Alternative Gene Name: 9G8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020409: 100%, ENSRNOG00000003822: 100%
Entrez Gene ID: 10569
Uniprot ID: O95391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEA |
| Gene Sequence | DSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEA |
| Gene ID - Mouse | ENSMUSG00000020409 |
| Gene ID - Rat | ENSRNOG00000003822 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLU7 pAb (ATL-HPA035907) | |
| Datasheet | Anti SLU7 pAb (ATL-HPA035907) Datasheet (External Link) |
| Vendor Page | Anti SLU7 pAb (ATL-HPA035907) at Atlas Antibodies |
| Documents & Links for Anti SLU7 pAb (ATL-HPA035907) | |
| Datasheet | Anti SLU7 pAb (ATL-HPA035907) Datasheet (External Link) |
| Vendor Page | Anti SLU7 pAb (ATL-HPA035907) |