Anti SLU7 pAb (ATL-HPA035907)

Atlas Antibodies

Catalog No.: ATL-HPA035907-25

Protein Description: SLU7 splicing factor homolog (S. cerevisiae)
Gene Name: SLU7
Alternative Gene Name: 9G8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020409: 100%, ENSRNOG00000003822: 100%
Entrez Gene ID: 10569
Uniprot ID: O95391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEA
• Gene Sequence: DSKRRITVRNLRIREDIAKYLRNLDPNSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEA
• Gene ID - Mouse: ENSMUSG00000020409
• Gene ID - Rat: ENSRNOG00000003822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.