Anti SLPI pAb (ATL-HPA027774 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027774-100

Protein Description: secretory leukocyte peptidase inhibitor
Gene Name: SLPI
Alternative Gene Name: ALK1, ALP, BLPI, HUSI, HUSI-I, WAP4, WFDC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017002: 55%, ENSRNOG00000046699: 58%
Entrez Gene ID: 6590
Uniprot ID: P03973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCV
• Gene Sequence: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCV
• Gene ID - Mouse: ENSMUSG00000017002
• Gene ID - Rat: ENSRNOG00000046699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLPI pAb (ATL-HPA027774 w/enhanced validation) – 1 Found

Han, Leo; Andrews, Walker; Wong, Karsten; Jensen, Jeffrey T. Conditionally reprogrammed macaque endocervical cells retain steroid receptor expression and produce mucus. Biology Of Reproduction. 2020;102(6):1191-1202.